The domain within your query sequence starts at position 53 and ends at position 606; the E-value for the Nucleopor_Nup85 domain shown below is 1.2e-181.

FIYIIRKDVDVYSQILRKLFNESHGIFVGLQKIEEELSGKSRKAQLVRVSKNYRSVIRAC
MEEMHQVAIAAKDPASGRQFSSQVSILSAMELIWNLCEILFIEVAPAGPLLLHLLDWVRL
HVCEVDSLSADVLGGDNPSKHENFWDLVTVLVLQGRLDEARQMLAKEADANPSCAGMCRV
LGDLMRTMPILSPGNTQTLTELELKWQHWREECERHLQDNTFAANPRLESLCKIMLGDEA
ALLEQKELLSNWYHFLVTRLLYSNPTVKPIDLHFYAQSSLDMFLGGESSPEPLDNILMAA
FEFDIHQVIKECSIALSNWWFVAHLTDLLDHCRLLQSHNLYFGSNMREFLLLEYASGLFA
HHSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVKSICKI
LAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGSAMMLS
DRLTFLGKYREFHRLYGEKRFGDAASLLLSLMTSQIAPRSFWMTLLTDALPLLEQKQVIF
SAEQTYELMRCLED

Nucleopor_Nup85

Nucleopor_Nup85
PFAM accession number:PF07575
Interpro abstract (IPR011502):

This is a family of nucleoporins conserved from yeast to human.

Nup85 Nucleoporin is an essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance. As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP98/Nup98 and NUP153 to the nucleus. The Nup107-160 complex seems to be required for spindle assembly during mitosis. NUP85 is required for membrane clustering of CCL2-activated CCR2. Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol-3-kinase-Rac-lammellipodium protrusion cascade [(PUBMED:15995708), (PUBMED:12718872), (PUBMED:16807356)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleopor_Nup85