The domain within your query sequence starts at position 403 and ends at position 627; the E-value for the Nucleos_tra2_C domain shown below is 4.1e-83.

HLLTASVMSAPAALAVAKLFWPETEKPKITLKSAMKMENGDSRNLLEAASQGASSSIPLV
ANIAANLIAFLALLSFVNSALSWFGSMFNYPELSFELICSYIFMPFSFMMGVDWQDSFMV
AKLIGYKTFFNEFVAYDHLSKLINLRKAAGPKFVNGVQQYMSIRSETIATYALCGFANFG
SLGIVIGGLTSIAPSRKRDIASGAMRALIAGTIACFMTACIAGIL

Nucleos_tra2_C

Nucleos_tra2_C
PFAM accession number:PF07662
Interpro abstract (IPR011657):

The concentrative nucleoside transporter (CNT) (TC 2.A.41) family includes Q62773, which is a purine-specific Na+-nucleoside cotransporter localised to the bile canalicular membrane [(PUBMED:7775409)]. It also includes Q62674, a Na+-dependent nucleoside transporter selective for pyrimidine nucleosides and adenosine, which also transports the anti-viral nucleoside analogues AZT and ddC [(PUBMED:8027026)].

This entry covers the C terminus of this family of transporters.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleos_tra2_C