The domain within your query sequence starts at position 144 and ends at position 458; the E-value for the Nucleoside_tran domain shown below is 4.5e-131.

MIKIVLINSFGAILQASLFGLAGVLPANYTAPIMSGQGLAGFFTSVAMICAIASGSELSE
SAFGYFITACAVVILAILCYLALPRTEFYRHYLQLNLAGPAEQETKLDLISKGEEPKGRR
EESGVPGPNSPPTNRNQSIKAILKSICVPALSVCFIFTVTIGLFPAVTAEVESSIAGTSP
WKSYFIPVACFLNFNVFDWLGRSLTAVCMWPGQDSRWLPVLVASRIVFIPLLMLCNVKAR
HCGAQRHHFVFKHDAWFIAFMAAFAFSNGYLASLCMCFGPKKVKPAEAETAGNIMSFFLC
LGLALGAVLSFLLRA

Nucleoside_tran

Nucleoside_tran
PFAM accession number:PF01733
Interpro abstract (IPR002259):

Nucleosides are hydrophilic molecules and require specialised transport proteins for permeation of cell membranes. There are two types of nucleoside transport processes: equilibrative bidirectional processes driven by chemical gradients and inwardly directed concentrative processes driven by an electrochemical gradient [(PUBMED:10353709)]. The two types of nucleoside transporters are classified into two families: the solute carrier (SLC) 29 and SLC28 families, corresponding to equilibrative and concentrative nucleoside transporters, respectively [(PUBMED:23506887)].

Equilibrative nucleoside transporters (ENTs) are integral membrane proteins which enable the movement of hydrophilic nucleosides and nucleoside analogues down their concentration gradients across cell membranes. ENT family members have been identified in humans, mice, fish, tunicates, slime molds, and bacteria [(PUBMED:12446811)].

GO process:nucleoside transmembrane transport (GO:1901642)
GO component:integral component of membrane (GO:0016021)
GO function:nucleoside transmembrane transporter activity (GO:0005337)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleoside_tran