SMART: Pfam domain Nudc

The domain within your query sequence starts at position 9 and ends at position 60; the E-value for the Nudc_N domain shown below is 3.7e-16.

RFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFN

Nudc_N

PFAM accession number:	PF14050
Interpro abstract (IPR025934):	Nuclear distribution gene C homologue (nudC) proteins form complexes with other nud proteins and are involved in several cellular division activities. Recently it was shown that nudC regulates platelet-activating factor (PAF) acetylhydrolase with PAF being a pro-inflammatory secondary lipidic messenger [ (PUBMED:19381437) ]. The N terminus of nudC proteins contain a highly conserved region consisting of a predicted three helix bundle. This entry represents the N-terminal conserved domain.

PFAM accession number:

PF14050

Interpro abstract (IPR025934):

Nuclear distribution gene C homologue (nudC) proteins form complexes with other nud proteins and are involved in several cellular division activities. Recently it was shown that nudC regulates platelet-activating factor (PAF) acetylhydrolase with PAF being a pro-inflammatory secondary lipidic messenger [ (PUBMED:19381437) ]. The N terminus of nudC proteins contain a highly conserved region consisting of a predicted three helix bundle. This entry represents the N-terminal conserved domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nudc_N