The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the Nuf2 domain shown below is 2.3e-43.
METLSFPRYNVAELVVHIRNKLLTGADGKNLSKSDFLPNPKSDVLYMIYMKALQLVYGVR LEHFYMMPMNIEVTYPHLMEGFLPVRSLFFYMDSFMPICRVNDFEIVDILNPRTNRTSRF LSGIINFIHFRETCLEKCEEFLLQNKSSM
Nuf2 |
---|
PFAM accession number: | PF03800 |
---|---|
Interpro abstract (IPR005549): | Nuf2 is part of the Ndc80 complex [ (PUBMED:11266451) ]. This complex binds to the spindle and is required for chromosome segregation and spindle checkpoint activity [ (PUBMED:12438418) (PUBMED:4654001) (PUBMED:15062103) (PUBMED:15235793) (PUBMED:15239953) (PUBMED:15548592) (PUBMED:17535814) ]. |
GO component: | kinetochore (GO:0000776), Ndc80 complex (GO:0031262) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuf2