The domain within your query sequence starts at position 14 and ends at position 1684; the E-value for the Nup192 domain shown below is < 1e-12.

WGPYKDIWQTVGSALWRRQPEAVHLLDMILKKHKPDFISLFKNPPKNVQQHEKIQKASSE
GVAIQGQQGTRLLPEQLIKEAFIISDLFDIGELSAVELLLAGEHQQPHFPGLTRGLVAVL
LYWDGKRCIANSLRTLIQSRRGKTWTLELSPELVSMTTRFTDELMEQGLTYKVLTLLSQI
DVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSPLPKDDTLLLIGHL
ERVTVEANGSLDAVNLCLLMALLYCFDTSFIDQSTEERDDMIHHLPLLTERQYVSTIHSR
LQDSQPWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAIAELAIADNVFLFLS
EAVVLAENFYQEEFYIRRIHSLITDFLAFMPMKVKQLKNRADEDARMIHMSIQMGNEPPI
SLRRDLEHLMLLIGELYKKNPFHLELALEYWCPSEPLQTPTVMGSYLGVAHQRPPQRQVV
LSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSSHVENIQGAGGSPV
SWEHFFHSLLLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAFLQLTSTIITWSEN
ARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIAASLWQSLEYTQIL
QTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPSNLGAGLRPPGFD
PYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGE
EIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALL
NLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKKADNVVNIARYLYHGNNNPELA
FESAKILCCISCNSNIQVKMVGDFTHDQSVSQKLMAGFVECLDYEDTEEFVRVEEGSELE
KKLAAIRHETRIHILNLLITSLERNPPNLALYLLGFELKKPISTTNLQDPGVLGCPRTCL
HAILNILEKGTEGRDGPVAVREYPQLADLCYQVIYQLCACSDTSGPTMRYLRTSQDFLFS
QLQHLPFSNKEHEISMLSQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYS
DGEGGMEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQLDFFDRAQIEQVI
ANCEHKNLQGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTILQYVVGRNKLL
QCLHAKRHALESWRQLVEIILTACPQELIQAEDRQLIIRDLLQDVHDKVLDDEAAQELMP
VVAGAVFTLTAHLSQAVRTEQRQPLVSGPGEAQYAFMLDSSLTSSPAAESRPVGFASIGD
SSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLT
APEDVFSKLQRENMAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQHQWL
LYLSNSGYLKVLVDSLVDDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKEQQGSAEL
LRSGVIVRLAQCQVYDMRPEMDSHGMFGMRDPPVFIPTPVDRYRQILLPALQLCQVILTS
SMSQHLQAAGQVLQFLVSHSDTIQAILRCQDVSTGSLQELALLTGIISKAA

Nup192

Nup192
PFAM accession number:PF11894
Interpro abstract (IPR021827): Proteins in this family are components of the nuclear pore complex (NPC). These protein are called nucleoporins (NUPs), which can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. This entry includes Nup186/Nup192/Nup205. In budding yeasts, Nup192 is located to the NPC core at the nuclear membrane and is essential for de novo assembly of NPCs [(PUBMED:10428845)]. In humans, Nup205 forms a complex with NUP53, NUP93, NUP155 and lamin B [(PUBMED:15703211)].
GO component:nuclear pore (GO:0005643)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nup192