The domain within your query sequence starts at position 11 and ends at position 747; the E-value for the Nup88 domain shown below is < 1e-12.

GELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTRNLVFGLGGEL
FLWDAEGSAFLVVRLRGPSGGGVEPPLSQYQRLLCINPPLFEIHQVLLSPTQHHVALIGS
KGLMALELPQRWGKDSEFEGGKATVNCSTIPIAERFFTSSTSLTLKHAAWYPSEMLDPHI
VLLTSDNVIRIYSLREPQTPTKVIVLSEAEEESLILNKGRAYTASLGETAVAFDFGPLVT
VSKNIFEQKDRDVVAYPLYILYENGETFLTYVSLLHSPGNIGKLLGPLPMHPAAEDNYGY
DACAILCLPCVPNILVIATESGMLYHCVVLEGEEEDDQTLEKSWDPRADFIPSLYVFECV
ELELALKLASGEDDPFASDFSCPIKLHRDPKCPSRYHCSHEAGVHSVGLTWIHKLHKFLG
SDEEDKDSLQELTAEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYEC
LIRPLLSTVHPASPPLLCTQEDAEVAESPLRILAETPDSFEKHIKRILQRSAANPAFLKN
CSARSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRRVKLLCDQKRKQLED
LNYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKVLHSFHAQLPVLSDSERDMKKE
LQLIPDQLRHLGNAIKQVTMKKDYQQRKMEKVLSPQKPTITLSAYQRKCIQSILKEEGEH
IREMVKQINDIRNHVTF

Nup88

Nup88
PFAM accession number:PF10168
Interpro abstract (IPR019321):

Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs. It is, however, where it binds to Nup98; one of the components of the nuclear pore. The C-terminal end is a predicted coiled-coil domain [(PUBMED:9049309)]. Nup88 is over expressed in tumour cells [(PUBMED:12589057)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nup88