The domain within your query sequence starts at position 628 and ends at position 660; the E-value for the OB_NTP_bind domain shown below is 2.7e-10.

RVIYNEVIQTSKYYMRDVTAIESAWLLELAPHF

OB_NTP_bind

OB_NTP_bind
PFAM accession number:PF07717
Interpro abstract (IPR011709):

This domain is found towards the C terminus of the DEAD-box helicases ( IPR011545 ). In these helicases it appears to be always found in association with IPR007502 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OB_NTP_bind