The domain within your query sequence starts at position 960 and ends at position 1076; the E-value for the OB_NTP_bind domain shown below is 5e-13.

VQLKEILINSGFPEDCLLTQVFTNTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEG
RNALIHKSSVNCPFSSQDMKYPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKK

OB_NTP_bind

OB_NTP_bind
PFAM accession number:PF07717
Interpro abstract (IPR011709):

This domain is found towards the C terminus of the DEAD-box helicases (IPR011545). In these helicases it appears to be always found in association with IPR007502.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OB_NTP_bind