The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the OCC1 domain shown below is 4.3e-38.
MGCGNSTATSAAAGRGPTGAVKDTTEDSITEDDKRRNYGGVYVGLPSEAVNMASSQTKTV QK
OCC1 |
 |
|---|
| PFAM accession number: | PF15506 |
|---|---|
| Interpro abstract (IPR029133): | The human member of this family, overexpressed in colon carcinoma 1 protein ( Q8TAD7 ) has been shown to be overexpressed in several colon carcinomas [ (PUBMED:11890990) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OCC1