The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the OCC1 domain shown below is 4.3e-38.

MGCGNSTATSAAAGRGPTGAVKDTTEDSITEDDKRRNYGGVYVGLPSEAVNMASSQTKTV
QK

OCC1

OCC1
PFAM accession number:PF15506
Interpro abstract (IPR029133):

The human member of this family, overexpressed in colon carcinoma 1 protein (Q8TAD7) has been shown to be overexpressed in several colon carcinomas [(PUBMED:11890990)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OCC1