The domain within your query sequence starts at position 1 and ends at position 58; the E-value for the OCIA domain shown below is 1.8e-22.

MLITQGLISKGILSSHPKYGSIPKLLFACIVGYFAGKLSYVKTCQEKFKKLENSPLGE

OCIA

OCIA
PFAM accession number:PF07051
Interpro abstract (IPR009764):

This domain can be found in several ovarian carcinoma immunoreactive antigen (OCIA) and related eukaryotic sequences. The function of these proteins is unknown [ (PUBMED:11162530) (PUBMED:12445744) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OCIA