The domain within your query sequence starts at position 3 and ends at position 112; the E-value for the OCIA domain shown below is 8.3e-44.
GRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLI SKGILSSHPKYGSIPKLLFACIVGYFAGKLSYVKTCQEKFKKLENSPLGE
OCIA |
---|
PFAM accession number: | PF07051 |
---|---|
Interpro abstract (IPR009764): | This domain can be found in several ovarian carcinoma immunoreactive antigen (OCIA) and related eukaryotic sequences. The function of these proteins is unknown [ (PUBMED:11162530) (PUBMED:12445744) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OCIA