The domain within your query sequence starts at position 18 and ends at position 118; the E-value for the OCRL_clath_bd domain shown below is 1.5e-47.

LEMKGPLREPCVLTLARRNGQYELIIQLHGKEQHVQDIIPINSHFRCVQEAEETLLIDIA
SNSGCKIRVQGDWTRERHFEIPDEERCLKFLSEVLEAQEAQ

OCRL_clath_bd

OCRL_clath_bd
PFAM accession number:PF16726
Interpro abstract (IPR031995):

This domain is a clathrin binding domain found at the N terminus of inositol polyphosphate 5-phosphatase OCRL. It has a PH domain-like fold [(PUBMED:19536138)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OCRL_clath_bd