The domain within your query sequence starts at position 108 and ends at position 210; the E-value for the ODC_AZ domain shown below is 5.3e-28.

NDKTRVLSIQSTLTEAKQVTWRAVWSGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLQA
DHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDAC

ODC_AZ

ODC_AZ
PFAM accession number:PF02100
Interpro abstract (IPR002993): Ornithine decarboxylase antizyme (ODC-AZ) [(PUBMED:7813017)] binds to, and destabilises, ornithine decarboxylase (ODC), a key enzyme in polyamine synthesis. ODC is then rapidly degraded. The expression of ODC-AZ requires programmed, ribosomal frameshifting which is modulated according to the cellular concentration of polyamines. High levels of polyamines induce a +1 ribosomal frameshift in the translation of mRNA for the antizyme leading to the expression of a full-length protein. At least two forms of ODC-AZ in mammals [(PUBMED:9782076)] and one homologue in Drosophila (protein Gutfeeling) have been identified.
GO function:ornithine decarboxylase inhibitor activity (GO:0008073)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ODC_AZ