The domain within your query sequence starts at position 1 and ends at position 92; the E-value for the OGFr_N domain shown below is 1.6e-38.

MMLEFFGIKLIDKTGNVARAGNWQERFQHLNESQHNYLRITRILKSLGELGYESFKSPLV
KFILHEALVENTIPNIKQSALEYFVYTIRDRR

OGFr_N

OGFr_N
PFAM accession number:PF04664
Interpro abstract (IPR006757):

Opioid peptides act as growth factors in neural and non-neural cells and tissues, in addition to serving in neurotransmission/neuromodulation in the nervous system. The opioid growth factor receptor is an integral membrane protein associated with the nucleus. This conserved domain is situated at the N terminus of the member proteins with a series of imperfect repeats lying immediately to its C-terminal [ (PUBMED:11890982) ].

GO component:membrane (GO:0016020)
GO function:signaling receptor activity (GO:0038023)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OGFr_N