The domain within your query sequence starts at position 25 and ends at position 141; the E-value for the OGG_N domain shown below is 4e-38.

SIPCPRSELRLDLVLASGQSFRWKEQSPAHWSGVLADQVWTLTQTEDQLYCTVYRGDDSQ
VSRPTLEELETLHKYFQLDVSLAQLYSHWASVDSHFQRVAQKFQGVRLLRQDPTECL

OGG_N

OGG_N
PFAM accession number:PF07934
Interpro abstract (IPR012904):

The presence of 8-oxoguanine residues in DNA can give rise to G-C to T-A transversion mutations. This enzyme is found in archaeal, bacterial and eukaryotic species, and is specifically responsible for the process which leads to the removal of 8-oxoguanine residues. It has DNA glycosylase activity (EC 3.2.2.23) and DNA lyase activity (EC 4.2.99.18) [(PUBMED:10706276)]. The region featured in this family is the N-terminal domain, which is organised into a single copy of a TBP-like fold. The domain contributes residues to the 8-oxoguanine binding pocket [(PUBMED:11902834)].

GO process:nucleotide-excision repair (GO:0006289)
GO function:damaged DNA binding (GO:0003684), oxidized purine nucleobase lesion DNA N-glycosylase activity (GO:0008534)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OGG_N