The domain within your query sequence starts at position 7 and ends at position 163; the E-value for the OHCU_decarbox domain shown below is 1e-41.
NSMDFGEFVDVFGNIVEKCPLIAAAVWSQRPFSGLEDLENHFFAFIDALPRSGQEGILRC HPDLAGRDLQQGTLTAESQREQSQAGLTSLDTDDRLRLQQLNAQYRERFGFPFVLAARLS DRATVPRELARRLQCQPESELRTALGEVKKISHLRLT
OHCU_decarbox |
![]() |
---|
PFAM accession number: | PF09349 |
---|---|
Interpro abstract (IPR018020): | The proteins in this entry are OHCU decarboxylase, an enzyme of the purine catabolism that catalyses the conversion of OHCU into S(+)-allantoin [ (PUBMED:16462750) ]; it is the third step of the conversion of uric acid (a purine derivative) to allantoin. Step one is catalysed by urate oxidase ( IPR002042 ) and step two is catalysed by hydroxyisourate hydrolase ( IPR000895 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OHCU_decarbox