The domain within your query sequence starts at position 225 and ends at position 413; the E-value for the ORC4_C domain shown below is 1.3e-51.

KIFKEQLSLPAEFPDKAFAERWNENVHCLSEDSTVLEVLQKHFSVNKNLQSLHMLLMLAL
NRVTVSHPFMTSADLMEAQHMCSLDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQ
MVYNEFQKFIQRKAHSVYNFEKPVVMKAFEHLQQLELIKPVERTSVNSQREYQLVKLLLD
NTQIMNALQ

ORC4_C

ORC4_C
PFAM accession number:PF14629
Interpro abstract (IPR032705):

This entry represents the C terminus of origin recognition complex subunit 4 [(PUBMED:9353276), (PUBMED:10077566)].

The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [(PUBMED:17241905)]. ORC is a central component for eukaryotic DNA replication, and binds chromatin at replication origins throughout the cell cycle [(PUBMED:17825065)]. ORC directs DNA replication throughout the genome and is required for its initiation [(PUBMED:1579162), (PUBMED:7585959), (PUBMED:16716188)]. ORC bound at replication origins serves as the foundation for assembly of the pre-replicative complex (pre-RC), which includes Cdc6, Tah11 (aka Cdt1), and the Mcm2-7 complex [(PUBMED:7892251), (PUBMED:7781615), (PUBMED:16228006)]. Pre-RC assembly during G1 is required for replication licensing of chromosomes prior to DNA synthesis during S phase [(PUBMED:10966477), (PUBMED:12045100), (PUBMED:15680967)]. Cell cycle-regulated phosphorylation of ORC2, ORC6, Cdc6, and MCM by the cyclin-dependent protein kinase Cdc28 regulates initiation of DNA replication, including blocking reinitiation in G2/M phase [(PUBMED:17825065), (PUBMED:11572976), (PUBMED:11429609), (PUBMED:16024805)].

In yeast, ORC also plays a role in the establishment of silencing at the mating-type loci Hidden MAT Left (HML) and Hidden MAT Right (HMR) [(PUBMED:1579162), (PUBMED:7585959), (PUBMED:16716188)]. ORC participates in the assembly of transcriptionally silent chromatin at HML and HMR by recruiting the Sir1 silencing protein to the HML and HMR silencers [(PUBMED:16716188), (PUBMED:8622770), (PUBMED:9171055)].

Both ORC1 and ORC5 bind ATP, although only ORC1 has ATPase activity [(PUBMED:9038340)]. The binding of ATP by ORC1 is required for ORC binding to DNA and is essential for cell viability [(PUBMED:16228006)]. The ATPase activity of ORC1 is involved in formation of the pre-RC [(PUBMED:11459976), (PUBMED:15610739), (PUBMED:16387651)]. ATP binding by ORC5 is crucial for the stability of ORC as a whole. Only the ORC1-5 subunits are required for origin binding; ORC6 is essential for maintenance of pre-RCs once formed [(PUBMED:17053779)]. Interactions within ORC suggest that ORC2-3-6 may form a core complex [(PUBMED:17825065)].

ORC homologues have been found in various eukaryotes, including fission yeast, insects, amphibians, and humans [(PUBMED:9442876)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ORC4_C