The domain within your query sequence starts at position 11 and ends at position 146; the E-value for the ORMDL domain shown below is 2.3e-56.

NPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAVKGT
PFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTAS
LLSVLIPKMPQLHGVR

ORMDL

 ORMDL
PFAM accession number:PF04061
Interpro abstract (IPR007203):

ORMDL family members include ORMDL1/2/3 from humans and their homologues, such as protein Orm1 and Orm2 from budding yeasts. ORMDLs may be involved in protein folding in the endoplasmic reticulum [ (PUBMED:12093374) ]. In budding yeast, Orm1 and Orm2 proteins mediate sphingolipid homeostasis [ (PUBMED:20182505) ].

GO component:integral component of membrane (GO:0016021), endoplasmic reticulum membrane (GO:0005789)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ORMDL