The domain within your query sequence starts at position 11 and ends at position 146; the E-value for the ORMDL domain shown below is 3.7e-56.
NPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGT PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVS LMTVLIPKLPQLHGVR
ORMDL |
---|
PFAM accession number: | PF04061 |
---|---|
Interpro abstract (IPR007203): | ORMDL family members include ORMDL1/2/3 from humans and their homologues, such as protein Orm1 and Orm2 from budding yeasts. ORMDLs may be involved in protein folding in the endoplasmic reticulum [ (PUBMED:12093374) ]. In budding yeast, Orm1 and Orm2 proteins mediate sphingolipid homeostasis [ (PUBMED:20182505) ]. |
GO component: | endoplasmic reticulum membrane (GO:0005789), integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ORMDL