The domain within your query sequence starts at position 11 and ends at position 146; the E-value for the ORMDL domain shown below is 4.4e-57.

NPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYIFLHTVKGT
PFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTAS
LLSVLLPKLPQFHGVR

ORMDL

ORMDL
PFAM accession number:PF04061
Interpro abstract (IPR007203):

ORMDL family members include ORMDL1/2/3 from humans and their homologues, such as protein Orm1 and Orm2 from budding yeasts. ORMDLs may be involved in protein folding in the endoplasmic reticulum [(PUBMED:12093374)]. In budding yeast, Orm1 and Orm2 proteins mediate sphingolipid homeostasis [(PUBMED:20182505)].

GO component:endoplasmic reticulum membrane (GO:0005789), integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ORMDL