The domain within your query sequence starts at position 474 and ends at position 511; the E-value for the OSR1_C domain shown below is 5.6e-19.

IALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVA

OSR1_C

OSR1_C
PFAM accession number:PF12202
Interpro abstract (IPR024678):

Oxidative-stress-responsive kinase 1 (OSR1) is involved in the signalling cascade which activates Na/K/2Cl co-transporter during osmotic stress. This entry represents the CCT domain found in OSR1, STE20/SPS1-related kinase and in WNK activators [(PUBMED:17721439)]. This domain is found in eukaryotes, and is approximately 40 amino acids in length. There is a single completely conserved residue F that may be functionally important.

GO function:protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OSR1_C