The domain within your query sequence starts at position 1 and ends at position 171; the E-value for the OSTMP1 domain shown below is 1.1e-67.
MQIVLMVSEFFNSTWQEANCANCLTNNGEDLSNNTEDFLSLFNKTLACFEHNLQGHTYSL LPPKNYSEVCRNCKEAYKNLSLLYSQMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSR TFNCSVTCSDTVSVVAVSVFILFLPVVFYLSSFLHSEQKKRKLILRKFPSV
OSTMP1 |
---|
PFAM accession number: | PF09777 |
---|---|
Interpro abstract (IPR019172): | Osteopetrosis-associated transmembrane protein 1 (OSTM1) is required for osteoclast and melanocyte maturation and function. Mutations in OSTM1 give rise to autosomal recessive osteopetrosis, also called autosomal recessive Albers-Schonberg disease [ (PUBMED:12627228) (PUBMED:16813530) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OSTMP1