The domain within your query sequence starts at position 1 and ends at position 122; the E-value for the OSTbeta domain shown below is 1.1e-55.

MDHSAEKAAANAEVPQELLEEMLWYFRAEDAAPWNYSILVLAVLVVMTSMFLLRRSILAN
RNRKKQPQDKETPEDLHLDDSIMKENNSQVFLRETLISEKPDLAPGEPELKEKDSSLVFL
PD

OSTbeta

OSTbeta
PFAM accession number:PF15048
Interpro abstract (IPR029387):

Organic solute transporter subunit beta (OSTbeta, also known as SLC51B) is an essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood [ (PUBMED:16317684) ].

OSTbeta is a single-TM domain polypeptide that forms a transporter complex with Ost-alpha protein, which is a 7-transmembrane (TM) domain containing protein. This heterodimerisation is required for the delivery of the complex to the plasma membrane. The OSTalpha-OSTbeta complex serves as a multispecific transporter that may participate in cellular uptake of bile acids, some endogenous and exogenous steroids, and eicosanoids. It functions via a facilitated diffusion mechanism. Interestingly, this transporter also transports dehydroepiandrosterone sulfate (DHEAS) and pregnenolone sulfate (PREGS), which are major excitatory neurosteroids. This suggests a possible function for OSTalpha-OSTbeta complex in the brain [ (PUBMED:23506901) ].

GO process:bile acid and bile salt transport (GO:0015721)
GO component:plasma membrane (GO:0005886)
GO function:transmembrane transporter activity (GO:0022857), protein heterodimerization activity (GO:0046982)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OSTbeta