The domain within your query sequence starts at position 21 and ends at position 89; the E-value for the OTOS domain shown below is 9.3e-42.

AKPMPEEADPHTQPPAMPYWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTL
GFHVPYQED

OTOS

OTOS
PFAM accession number:PF15182
Interpro abstract (IPR028224):

Otospiralin, has a role in maintaining the neurosensory epithelium of the inner ear [(PUBMED:11880501)]. Otospiralin is also expressed in the central nervous system, where could be involved in signalling pathways and play a role in repair mechanisms [(PUBMED:18832023)].

GO process:sensory perception of sound (GO:0007605)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OTOS