The domain within your query sequence starts at position 5 and ends at position 116; the E-value for the Ocnus domain shown below is 1e-44.

LGQIPDVDIDSDGVFKYVLIRVHLAEPSGDPAKECKEIVRGYKWAEYHADIYDKVSGELQ
RNGYDCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYE

Ocnus

Ocnus
PFAM accession number:PF05005
Interpro abstract (IPR007702): This family is comprised of the 14 kDa phosphohistidine phosphatase from mammals and Janus-A/Janus-B proteins from Drosophila melanogaster. Janus-A and Janus-B regulate somatic sex differentiation and have been found to be testes specific [(PUBMED:11319264)]. 14 kDa phosphohistidine phosphatase is a histidine phosphatase that may play a role of reversible histidine phosphorylation in neuronal functions [(PUBMED:12468887)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ocnus