SMART: Pfam domain Ocnus

The domain within your query sequence starts at position 5 and ends at position 116; the E-value for the Ocnus domain shown below is 1e-44.

LGQIPDVDIDSDGVFKYVLIRVHLAEPSGDPAKECKEIVRGYKWAEYHADIYDKVSGELQ
RNGYDCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYE

Ocnus

PFAM accession number:	PF05005
Interpro abstract (IPR007702):	This family is comprised of the 14kDa phosphohistidine phosphatase from mammals and Janus-A/Janus-B proteins from Drosophila melanogaster. Janus-A and Janus-B regulate somatic sex differentiation and have been found to be testes specific [ (PUBMED:11319264) ]. 14kDa phosphohistidine phosphatase is a histidine phosphatase that may play a role of reversible histidine phosphorylation in neuronal functions [ (PUBMED:12468887) ].

PFAM accession number:

PF05005

Interpro abstract (IPR007702):

This family is comprised of the 14kDa phosphohistidine phosphatase from mammals and Janus-A/Janus-B proteins from Drosophila melanogaster. Janus-A and Janus-B regulate somatic sex differentiation and have been found to be testes specific [ (PUBMED:11319264) ]. 14kDa phosphohistidine phosphatase is a histidine phosphatase that may play a role of reversible histidine phosphorylation in neuronal functions [ (PUBMED:12468887) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ocnus