The domain within your query sequence starts at position 11 and ends at position 161; the E-value for the Olfactory_mark domain shown below is 7.6e-82.

LEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNV
VLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLS
DLAKIRKVMYFLITFGEGVEPANLKASVVFN

Olfactory_mark

Olfactory_mark
PFAM accession number:PF06554
Interpro abstract (IPR009103):

Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology [(PUBMED:12054873)]. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [(PUBMED:12054872)].

GO process:signal transduction (GO:0007165), sensory perception of smell (GO:0007608)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Olfactory_mark