The domain within your query sequence starts at position 1 and ends at position 129; the E-value for the Orexin domain shown below is 2.2e-77.

MNFPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAA
GILTLGKRRPGPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPHPCSGRGCPTVTTT
ALAPRGGSG

Orexin

Orexin
PFAM accession number:PF02072
Interpro abstract (IPR001704):

Orexins (also known as hypocretins) are neuropeptides that are specifically localised to the hypothalamus. They are thought to interact with autonomic, neurendocrine and neuroregulatory systems, and play an important role in the regulation of feeding behaviour [(PUBMED:9892705), (PUBMED:9419374)]. When applied to hypothalamic neurones, these peptides are neuroexcitatory, which action is probably mediated by their binding to a new family of G-protein-coupled receptors (orexin receptors 1 and 2), which were previously orphan [(PUBMED:9491897)].

To date, two orexins have been characterised (orexin-A and -B), both encoded by a single mRNA transcript (prepro-orexin): orexin-A is a 33-residue peptide with two intramolecular disulphide bonds in the N-terminal region; and orexin-B is a linear 28-residue peptide. These peptides have 46% identity at the amino acid sequence level, and show some similarity to the glucagon/vasoactive intestinal polypeptide/secretin peptide family.

GO process:neuropeptide signaling pathway (GO:0007218), feeding behavior (GO:0007631)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Orexin