The domain within your query sequence starts at position 386 and ends at position 443; the E-value for the Orexin_rec2 domain shown below is 1.2e-37.

HHRQGDRLARGRTSTESRKSLTTQISNFDNVSKLSEHVVLTSISTLPAANGAGPLQNW

Orexin_rec2

Orexin_rec2
PFAM accession number:PF03827
Interpro abstract (IPR004060):

The neuropeptide hormone orexin stimulates appetite and food consumption [ (PUBMED:9656726) ], and is found in the hypothalamus, which has been shown to be the 'feeding centre' and plays a central role in the integrated control of feeding and energy homeostasis [ (PUBMED:9491897) ]. It also has a prominent role in promoting wakefulness [ (PUBMED:10458611) (PUBMED:10615891) (PUBMED:10481909) ]. The orexin receptor (also referred to as the hypocretin receptor) is a rhodopsin-like G protein-coupled receptor that binds orexin. There are two subtypes; orexin receptor 1 (OX1) and orexin receptor 2 (OX2) [ (PUBMED:16507882) ].

This entry represents Orexin receptor 2, which is found throughout vertebrates and, like OX1, is expressed in brainstem and striatal nuclei, with additional expression in arousal promoting histaminergic nuclei [ (PUBMED:9821961) (PUBMED:21216246) (PUBMED:11370008) ]. Both Orexin-A and B have nearly equal affinity for OX2 [ (PUBMED:9491897) ], and stimulate intracellular calcium levels through OX2-mediated induction of Gq and phospholipase C activity, but is also capable of activating Gs, Gi, and potentially ion channels [ (PUBMED:10498827) (PUBMED:12208495) (PUBMED:11600545) (PUBMED:11600545) ]. The OX2 receptor predominantly mediate the control of arousal induced by orexin neuropeptides [ (PUBMED:12797957) (PUBMED:10458611) ].

GO process:feeding behavior (GO:0007631), G protein-coupled receptor signaling pathway (GO:0007186), circadian sleep/wake cycle process (GO:0022410)
GO component:integral component of membrane (GO:0016021)
GO function:orexin receptor activity (GO:0016499)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Orexin_rec2