SMART: Pfam domain Ost4

The domain within your query sequence starts at position 1 and ends at position 35; the E-value for the Ost4 domain shown below is 3.7e-16.

MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKK

Ost4

PFAM accession number:	PF10215
Interpro abstract (IPR018943):	Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, EC 2.4.1.119 that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum.

PFAM accession number:

PF10215

Interpro abstract (IPR018943):

Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, EC 2.4.1.119 that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ost4