The domain within your query sequence starts at position 487 and ends at position 564; the E-value for the Otopetrin domain shown below is 2.2e-12.

LRRASRAYIHSFSHLNWKRRMLKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYR
TWFTIVNFGLPLGVFYRM

Otopetrin

Otopetrin
PFAM accession number:PF03189
Interpro abstract (IPR004878):

The otopetrins are a group of proteins that are restricted to the metazoa. The structure of otopetrin-1 (Q80VM9) shows it to have 12 transmembrane domains, with three conserved sub-domains (OD-1 to OD-III) [(PUBMED:18254951)]. Otopetrins modulate calcium homeostasis and influx of calcium in response to extracellular ATP.

The otopetrins are required for normal formation of otoconia/otoliths in the inner ear. Otoconia are minute biomineral particles embedded in a gelatinous membrane that overlies the sensory epithelium in the inner ear. Gravity and acceleration cause the octoconia to deflect the stereocilia of sensory hair cells. Otoconia are required for normal processing of information regarding spatial orientation and acceleration.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Otopetrin