The domain within your query sequence starts at position 98 and ends at position 208; the E-value for the Oxidored_q6 domain shown below is 1.9e-25.
ACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRY VVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQL
Oxidored_q6 |
 |
|---|
| PFAM accession number: | PF01058 |
|---|---|
| Interpro abstract (IPR006137): | This entry represents a Rossmann fold-type domain found in NADH:ubiquinone oxidoreductase 20kDa subunit, [NiFe] hydrogenase small subunit and coenzyme F420 hydrogenase subunit gamma. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Among the many polypeptide subunits that make up complex I, there is one with a molecular weight of 20kDa (in mammals) [ (PUBMED:1577158) ], which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 4Fe-4S iron-sulphur cluster. The great majority of hydrogenases (H2ases) contain iron-sulfur clusters and two metal atoms at their active centre, Ni and Fe in the case of the [NiFe]-H2ases. They catalyse the reversible oxidation of hydrogen gas and play a central role in microbial energy metabolism; in addition to their role in fermentation and H2 respiration [ (PUBMED:15119826) ]. The small subunit (chain A) contains the Fe4S4 clusters, whereas the large subunit (chain B) binds the binuclear NiFe active site [ (PUBMED:20026074) ]. |
| GO process: | oxidation-reduction process (GO:0055114) |
| GO function: | iron-sulfur cluster binding (GO:0051536) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Oxidored_q6