The domain within your query sequence starts at position 880 and ends at position 1025; the E-value for the OxoGdeHyase_C domain shown below is 8.7e-58.

RTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAIT
RIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGR
DPAAAPATGNKKTHLTELQRFLDTAF

OxoGdeHyase_C

OxoGdeHyase_C
PFAM accession number:PF16870
Interpro abstract (IPR031717):

This domain is found immediately C-terminal to the transketolase-like pyrimidine-binding domain (IPR005475). It is found at the C terminus of multifunctional 2-oxoglutarate metabolism enzyme Kgd [(PUBMED:21867916)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OxoGdeHyase_C