The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the P-mevalo_kinase domain shown below is 5.6e-19.
MICWGEQKRQADPGFFCRKIVEGVSQPIWLVSDTRRTSDIQWFQEAYGAVIQTV
P-mevalo_kinase |
---|
PFAM accession number: | PF04275 |
---|---|
Interpro abstract (IPR005919): | Phosphomevalonate kinase ( EC 2.7.4.2 ) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the higher eukaryotic form and the ERG8 type. This model represents the form of the enzyme found in animals. |
GO process: | cholesterol biosynthetic process (GO:0006695) |
GO component: | cytoplasm (GO:0005737) |
GO function: | phosphomevalonate kinase activity (GO:0004631) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry P-mevalo_kinase