The domain within your query sequence starts at position 4 and ends at position 54; the E-value for the P19Arf_N domain shown below is 4.6e-26.
RFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILR
P19Arf_N |
---|
PFAM accession number: | PF07392 |
---|---|
Interpro abstract (IPR010868): | ARF (also known as p14ARF in the human and p19ARF in the mouse) is an alternative transcript of the INK4a/ARF tumour-suppressor locus that encodes p16INK4a, an inhibitor of cyclin dependent kinases. ARFs are tumour suppressors participating in p53-dependent or independent pathways that restrain abnormal cell growth and maintain genomic stability [ (PUBMED:25723571) (PUBMED:16600663) (PUBMED:12660818) ]. ARF interacts with MDM2 and neutralizes MDM2's inhibition of p53 [ (PUBMED:11331246) ]. Mdm2 may also regulate ARF turnover by mediating its degradation through the proteasome [ (PUBMED:25723571) ]. p14ARF has also been shown to interact with E2F factors to form p14ARF-E2F/partner-DNA complexes repressing E2F-dependent transcription [ (PUBMED:20082327) ]. |
GO process: | negative regulation of cell population proliferation (GO:0008285), apoptotic process (GO:0006915), cell cycle arrest (GO:0007050) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry P19Arf_N