The domain within your query sequence starts at position 14 and ends at position 69; the E-value for the P33MONOX domain shown below is 4.3e-29.

SGPLGKMSLPIGMCRRAFSYDDALEDPAPMTPPPSDMGSIPWKPVIPERKYQHLDK

P33MONOX

P33MONOX
PFAM accession number:PF15302
Interpro abstract (IPR026759):

Proteins in this family are potential NADPH-dependent oxidoreductases. In human, it interacts with COBRA1, NOL12 and PRNP and may be involved in the regulation of neuronal survival, differentiation and axonal outgrowth [ (PUBMED:21153684) ]. It has been found down-regulated in the occipital lobe of an early stage Alzheimer's disease patients [ (PUBMED:17032350) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry P33MONOX