The domain within your query sequence starts at position 163 and ends at position 359; the E-value for the P53 domain shown below is 3.6e-110.

PAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQG
AVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITG
RQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEA
RICACPGRDRKADEDSI

P53

P53
PFAM accession number:PF00870
Interpro abstract (IPR011615):

P53 is a tumor suppressor gene product; mutations in p53 or lack of expression are found associated with a large fraction of all human cancers. P53 is activated by DNA damage and acts as a regulator of gene expression that ultimatively blocks progression through the cell cycle. P53 binds to DNA as a tetrameric transcription factor. In its inactive form, p53 is bound to the ring finger protein Mdm2, which promotes its ubiquitinylation and subsequent proteosomal degradation. Phosphorylation of p53 disrupts the Mdm2-p53 complex, while the stable and active p53 binds to regulatory regions of its target genes, such as the cyclin-kinase inhibitor p21, which complexes and inactivates cdk2 and other cyclin complexes [(PUBMED:20066118), (PUBMED:12629332), (PUBMED:1397838), (PUBMED:6544917), (PUBMED:19826090), (PUBMED:19776744), (PUBMED:6278740), (PUBMED:221923), (PUBMED:6318442), (PUBMED:20030809)].

This domain is found in p53 transcription factors, where it is responsible for DNA-binding. The DNA-binding domain acts to clamp, or in the case of TonEBP, encircle the DNA target in order to stabilise the protein-DNA complex [(PUBMED:11780147)]. Protein interactions may also serve to stabilise the protein-DNA complex, for example in the STAT-1 dimer the SH2 (Src homology 2) domain in each monomer is coupled to the DNA-binding domain to increase stability [(PUBMED:9630226)]. The DNA-binding domain consists of a beta-sandwich formed of 9 strands in 2 sheets with a Greek-key topology. This structure is found in many transcription factors, often within the DNA-binding domain.

GO function:transcription regulatory region DNA binding (GO:0044212)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry P53