The domain within your query sequence starts at position 391 and ends at position 432; the E-value for the P53_tetramer domain shown below is 2.2e-20.

KKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTI

P53_tetramer

P53_tetramer
PFAM accession number:PF07710
Interpro abstract (IPR010991):

The p53 protein is a tetrameric transcription factor that plays a central role in the prevention of neoplastic transformation [(PUBMED:7878469)]. Oligomerization appears to be essential for the tumour suppressing activity of p53. p53 can be divided into different functional domains: an N-terminal transactivation domain, a proline-rich domain, a DNA-binding domain (IPR008967), a tetramerisation domain and a C-terminal regulatory region. The tetramerisation domain of human p53 extends from residues 325 to 356, and has a 4-helical bundle fold. The tetramerisation domain is essential for DNA binding, protein-protein interactions, post-translational modifications, and p53 degradation [(PUBMED:11420672)].

GO process:protein tetramerization (GO:0051262)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry P53_tetramer