The domain within your query sequence starts at position 132 and ends at position 175; the E-value for the P66_CC domain shown below is 8.1e-24.
SSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKP
P66_CC |
![]() |
---|
PFAM accession number: | PF16563 |
---|---|
Interpro abstract (IPR032346): | This entry represents a short coiled-coil interaction region found in the transcriptional repressors P66alpha and P66beta. P66alpha and P66beta form complex with MBDs (methyl-binding domain-containing proteins) via a coiled-coil region on each. The MBD2-NuRD complex recognizes methylated DNA and silences expression of associated genes through histone deacetylase and nucleosome remodeling functions [ (PUBMED:21490301) (PUBMED:23239876) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry P66_CC