The domain within your query sequence starts at position 58 and ends at position 153; the E-value for the PA domain shown below is 1.7e-12.

SLENATSLSLMNLTGTALCHLSDIPPDGIRNKAVVVHWGPCHFLEKARIAQEGGAAALLI
ANNSVLIPSSRNKSTFQNVTVLIAVITQKDFKDMKE

PA

PA
PFAM accession number:PF02225
Interpro abstract (IPR003137): The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [(PUBMED:7674922)]. The PA domain is also found in a plant vacuolar sorting receptor O22925 and members of the RZF family, e.g. O43567.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PA