The domain within your query sequence starts at position 82 and ends at position 178; the E-value for the PA domain shown below is 1e-13.
ERVSGAVVLPEGWNQNACSPLTNFSRPDQTDTWLALIERGGCTFTHKINLAAEKGANGVI
IYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLH
PA |
 |
---|
PFAM accession number: | PF02225 |
---|
Interpro abstract (IPR003137): |
The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [(PUBMED:7674922)]. The PA domain is also found in a plant vacuolar sorting receptor O22925 and members of the RZF family, e.g. O43567. It has been suggested that this domain forms a lid-like structure that covers the active site in active proteases, and is involved in protein recognition in vacuolar sorting receptors [(PUBMED:11246007)].
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PA