The domain within your query sequence starts at position 34 and ends at position 119; the E-value for the PAC3 domain shown below is 1.9e-31.
VVVTQFGKMGTLVSLEPSNVANDISKPVLTTRVLLGQDEPLIHVFAKNLVAFVSQEAGNR AVLLAMAVKDKSMERLKALKEVIRLC
PAC3 |
 |
|---|
| PFAM accession number: | PF10178 |
|---|---|
| Interpro abstract (IPR018788): | Proteasome assembly chaperone 3 (PSMG3) promotes assembly of the 20S proteasome [ (PUBMED:17189198) ]. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAC3