The domain within your query sequence starts at position 3576 and ends at position 3657; the E-value for the PACT_coil_coil domain shown below is 1.2e-27.

KYLRASSFRKALIYQKKYLLLLLGGFQECEDVTLGVLARMGGHLALKDSKTITNHPKAFS
RFRSAVRVSIAISRMKFLVRRW

PACT_coil_coil

PACT_coil_coil
PFAM accession number:PF10495
Interpro abstract (IPR019528):

This entry represents a coiled-coil region close to the C terminus of centrosomal proteins that is directly responsible for recruiting AKAP-450 and pericentrin to the centrosome. Hence the suggested name for this region is a PACT domain (pericentrin-AKAP-450 centrosomal targeting). This domain is also present at the C terminus of coiled-coil proteins from Drosophila and Schizosaccharomyces pombe (Fission yeast), and in the Drosophila protein it is sufficient for targeting to the centrosome in mammalian cells. The function of these proteins is unknown but they seem good candidates for having a centrosomal or spindle pole body location. The final 22 residues of this domain in AKAP-450 appear specifically to be a calmodulin-binding domain, indicating that this protein at least is likely to contribute to centrosome assembly [(PUBMED:11263498)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PACT_coil_coil