The domain within your query sequence starts at position 14 and ends at position 103; the E-value for the PAD_N domain shown below is 3.9e-29.
PILPALLRAVPEGTDMFEVYGTPGVDIYVSPSMERSRERADTRRWCFNKGLEIIVIMNSP SNDLNDSHVQIAYHSSREHLPLAYAVLYLT
PAD_N |
---|
PFAM accession number: | PF08526 |
---|---|
Interpro abstract (IPR013732): | This entry represents the N-terminal non-catalytic domain of protein-arginine deiminase. This domain has a cupredoxin-like fold. |
GO component: | cytoplasm (GO:0005737) |
GO function: | calcium ion binding (GO:0005509), protein-arginine deiminase activity (GO:0004668) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAD_N