The domain within your query sequence starts at position 78 and ends at position 431; the E-value for the PAE domain shown below is 6.2e-97.

KSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESKGSRRWLLFLEGGWYC
FNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSG
ASPKSDKNEYAFMGSLIIQEVVRELLGKGLSGAKVLLLAGSSAGGTGVLLNVDRVAELLE
ELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTDAIRRGIRYWSGMVPERCQRQF
KEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGQWLYIQNLGRE
LRGTLKDVQASFAPACLSHEIIIRSYWTDVQVKGTSLPRALHCWDRSFHDSHKA

PAE

PAE
PFAM accession number:PF03283
Interpro abstract (IPR004963): This family includes protein Notum from animals and pectinacetylesterase (PAE) from plants. Notum is a carboxylesterase that removes an essential palmitoleate moiety from Wnt proteins. Notum constitutes the first known extracellular protein deacylase [(PUBMED:25731175), (PUBMED:25771893)]. PAEs catalyse the deacetylation of pectin, a major compound of primary cell walls [(PUBMED:12026180), (PUBMED:25115560)].
GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAE