SMART: Pfam domain PAF

The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the PAF domain shown below is 1.4e-37.

MVRTKANYVPGAYRKAVASQAPRKVLGSSTFVTNSSSSSRKAENKYAGGNPVCVRPTPKW
QKGIGEFFRLSPK

PAF

PFAM accession number:	PF15715
Interpro abstract (IPR031444):	PCNA-associated factor or p15PAF is a nuclear protein first identified as a proliferating-cell-nuclear-antigen (PCNA)-binding protein [ (PUBMED:11313979) ]. As a direct transcriptional target of activating transcription factor 3 (ATF3) it is involved in maintaining genomic integrity after UV exposure [ (PUBMED:19219066) ]. It is also a direct transcriptional target of the Rb/E2F pathway, playing an essential role in DNA synthesis and cell cycle progression [ (PUBMED:23593430) ]. p15PAF/KIAA0101 is overexpressed in multiple types of human cancer [ (PUBMED:21689861) (PUBMED:22576474) (PUBMED:24197986) ]. This domain corresponds to a histone-like fold in p15(PAF).

PFAM accession number:

PF15715

Interpro abstract (IPR031444):

PCNA-associated factor or p15PAF is a nuclear protein first identified as a proliferating-cell-nuclear-antigen (PCNA)-binding protein [ (PUBMED:11313979) ]. As a direct transcriptional target of activating transcription factor 3 (ATF3) it is involved in maintaining genomic integrity after UV exposure [ (PUBMED:19219066) ]. It is also a direct transcriptional target of the Rb/E2F pathway, playing an essential role in DNA synthesis and cell cycle progression [ (PUBMED:23593430) ]. p15PAF/KIAA0101 is overexpressed in multiple types of human cancer [ (PUBMED:21689861) (PUBMED:22576474) (PUBMED:24197986) ].

This domain corresponds to a histone-like fold in p15(PAF).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAF