The domain within your query sequence starts at position 1 and ends at position 379; the E-value for the PAF-AH_p_II domain shown below is 4.7e-157.

MGAGQSVCFPPISGPHHIGCTDVMEGHSLEGSLFRLFYPCQASEKCEQPLWIPRYEYSMG
LADYLQYNKRWVGLLFNVGIGSCRLPVSWNGPFKAKESGYPLIILSHGLGGFRASYSAFC
MELASRGFVVAAVEHRDQSAAATYFCKPTSQESSPAESLEEEWLPFRRIKEGEKEFHVRN
PQVHQRVKECVRVLRILQDASAGKTVVNVFPGGLDLMTLKGSIDRNRVAVMGHSFGGATA
VLALTQEVQFRCAIALDAWMFPLERDFYPKARGPVFFINVEKFQTVESVNLMKKICAQHE
QSRIVTVLGAVHRSQTDFAFVTGNLIAKFFSSNSRGTLDPYESQEVMVRAILAFLQKHLD
LKEDYDQWSSFIEGVGPSL

PAF-AH_p_II

PAF-AH_p_II
PFAM accession number:PF03403
Interpro abstract (IPR005065):

Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipase A2, and is involved in regulation of inflammation through the inactivation of platelet-activating factor and polar phospholipids [(PUBMED:9645224)].

GO process:lipid catabolic process (GO:0016042)
GO function:1-alkyl-2-acetylglycerophosphocholine esterase activity (GO:0003847)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAF-AH_p_II