The domain within your query sequence starts at position 1 and ends at position 429; the E-value for the PAG domain shown below is 8.7e-209.

MGPAGSVLSSGQMQMQMVLWGSLAAVAMFFLITFLVLLCSTCDREKKPRQHSGDHENLMN
VPSDKDMFSHSATSLTTDALASSEQNGVLTNGDILSEDSTLTCMQHYEEVQTSASDLLDS
QDSTGKAKCHQSRELPRIPPENAVDEILTARAADTELGPGVEGPYEVLKDSSSQENMVED
CLYETVKEIKEVADKGQGGKSKSTSALKELQGAPMEGKADFAEYASVDRNKKCRHSANAE
SILGTCSDLDEESPPPVPVKLLDENANLPQEGGGQAEEQAAEGTGGHSKRFSSLSYKSRE
EDPTLTEEEISAMYSSVNKPGQSAHKPGPCMKGPESACHSMKGLPQRSSSSCNDLYATVK
DFEKTPNSISTLPPARRPSEEPEPDYEAIQTLNREDEKVPLETNGHHVPKESDYESIGDL
QQCRDVTRL

PAG

PAG
PFAM accession number:PF15347
Interpro abstract (IPR032748):

PAG, or Cbp/PAG (Csk binding protein/phospho-protein associated with glycosphingolipid-enriched microdomains) is a transmembrane protein that has a negative regulatory role in T-cell activation through being an adapter for C-terminal Src kinase, Csk. This family of proteins is found in eukaryotes [(PUBMED:10790433), (PUBMED:11684085), (PUBMED:12612075), (PUBMED:22659621)].

GO process:intracellular signal transduction (GO:0035556), negative regulation of T cell activation (GO:0050868)
GO component:membrane raft (GO:0045121), plasma membrane (GO:0005886)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAG