The domain within your query sequence starts at position 2 and ends at position 429; the E-value for the PAG domain shown below is 1.4e-208.

GPAGSVLSSGQMQMQMVLWGSLAAVAMFFLITFLVLLCSTCDREKKPRQHSGDHENLMNV
PSDKDMFSHSATSLTTDALASSEQNGVLTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQ
DSTGKAKCHQSRELPRIPPENAVDEILTARAADTELGPGVEGPYEVLKDSSSQENMVEDC
LYETVKEIKEVADKGQGGKSKSTSALKELQGAPMEGKADFAEYASVDRNKKCRHSANAES
ILGTCSDLDEESPPPVPVKLLDENANLPQEGGGQAEEQAAEGTGGHSKRFSSLSYKSREE
DPTLTEEEISAMYSSVNKPGQSAHKPGPCMKGPESACHSMKGLPQRSSSSCNDLYATVKD
FEKTPNSISTLPPARRPSEEPEPDYEAIQTLNREDEKVPLETNGHHVPKESDYESIGDLQ
QCRDVTRL

PAG

PAG
PFAM accession number:PF15347
Interpro abstract (IPR032748):

PAG, or Cbp/PAG (Csk binding protein/phospho-protein associated with glycosphingolipid-enriched microdomains) is a transmembrane protein that has a negative regulatory role in T-cell activation through being an adapter for C-terminal Src kinase, Csk. This family of proteins is found in eukaryotes [(PUBMED:10790433), (PUBMED:11684085), (PUBMED:12612075), (PUBMED:22659621)].

GO process:negative regulation of T cell activation (GO:0050868), intracellular signal transduction (GO:0035556)
GO component:plasma membrane (GO:0005886), membrane raft (GO:0045121)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAG