The domain within your query sequence starts at position 755 and ends at position 1102; the E-value for the PALB2_WD40 domain shown below is 2.4e-183.

EQTETADRPACDNLNPGNLQLVSELKNPSSSCSVDVSAMWWERAGAKEPCIVTACEDVVS
LWKPLNSLQWEKVHTWHFTEVPVLQIVPVPDVYNLICVALGSLEIREIRALLCSSGDDSE
KQVLLKSGDIKAMLGLTKRRLVSSTGTFCNQQIQIMTFADDGSSKDEQLLMPPDETVLTF
AEVQGTQEALLGTTTVNSIVIWNLKTGQLLKKMHIDDSYQASVCHGAYSEKGLLFVVVSQ
PCAKESQALGSPVFQLLVINPKTAQSVGVLLCSLPQGQAGRFLEGDVKDHVAAAVLTSGT
IAIWDLLLGHCTALLPPVSDQSWSLVKWSGTDSHLLAGQKDGNIFIYR

PALB2_WD40

PALB2_WD40
PFAM accession number:PF16756
Interpro abstract (IPR031920):

This domain is found at the C terminus of partner and localiser of BRCA2 (PALB2). It is a seven-bladed WD40-type beta-propeller. It binds to the N terminus of BRCA2 [(PUBMED:19609323)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PALB2_WD40